DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ninaA and Ppial4g

DIOPT Version :9

Sequence 1:NP_476656.1 Gene:ninaA / 33271 FlyBaseID:FBgn0002936 Length:237 Species:Drosophila melanogaster
Sequence 2:XP_341364.2 Gene:Ppial4g / 361080 RGDID:1559682 Length:195 Species:Rattus norvegicus


Alignment Length:172 Identity:64/172 - (37%)
Similarity:98/172 - (56%) Gaps:14/172 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 VTSRIYMDVKHNKKPVGRITFGLFGKLAPKTVANFRHICLRGINGTSYVGSRFHRVVDRFLVQGG 89
            |...::.::..:.:|:||::..||....|:|..|||.: ..|..|..|.||.|||::..|:.|||
  Rat     2 VNLTMFFNITADGEPLGRVSLELFADKVPRTAENFRSL-TTGEKGFGYKGSSFHRIIPGFMCQGG 65

  Fly    90 DIVNGDGTGSISIYGDYFPDEDKALAVEHNRPGYLGMANRGPDTNGCQFYVTTVGAKWLDGKHTV 154
            .:...:|||..||||:.|  |:.:..::|..||.|.|||.||:|||.||::.|...:.||||..|
  Rat    66 KVTCHNGTGGKSIYGEKF--ENDSFILKHTGPGILSMANAGPNTNGSQFFICTAKTERLDGKCVV 128

  Fly   155 FGKVLEGMDTIYAIE-----DVKTDTDDFPVEPVVISNCGEI 191
            |||...|.:.:.|:|     :.||.      :.:.||:||::
  Rat   129 FGKGRGGTNIVEAMEHFGSRNGKTS------KKITISDCGQL 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ninaANP_476656.1 cyclophilin 27..189 CDD:294131 61/166 (37%)
Ppial4gXP_341364.2 cyclophilin 7..162 CDD:294131 61/163 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.