DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ninaA and Ppil1

DIOPT Version :9

Sequence 1:NP_476656.1 Gene:ninaA / 33271 FlyBaseID:FBgn0002936 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_001029360.1 Gene:Ppil1 / 309651 RGDID:1309119 Length:166 Species:Rattus norvegicus


Alignment Length:160 Identity:67/160 - (41%)
Similarity:93/160 - (58%) Gaps:17/160 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 IYMDVKHNKKPVGRITFGLFGKLAPKTVANFRHICLRGINGTSYVGSRFHRVVDRFLVQGGDIVN 93
            :|::..     :|.|...|:.|.||||..||..:..||.    |.|::|||::..|::|||| ..
  Rat    14 VYLETS-----MGIIVLELYWKHAPKTCKNFAELARRGY----YNGTKFHRIIKDFMIQGGD-PT 68

  Fly    94 GDGTGSISIYGDYFPDE---DKALAVEHNRPGYLGMANRGPDTNGCQFYVTTVGAKWLDGKHTVF 155
            |.|.|..||||..|.||   |    ::....|.|.|||.||||||.||:||....:|||||||:|
  Rat    69 GTGRGGASIYGKQFEDELHPD----LKFTGAGILAMANAGPDTNGSQFFVTLAPTQWLDGKHTIF 129

  Fly   156 GKVLEGMDTIYAIEDVKTDTDDFPVEPVVI 185
            |:|.:|:..:..:..|:|::.|.||:.|.|
  Rat   130 GRVCQGIGMVNRVGMVETNSQDRPVDDVKI 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ninaANP_476656.1 cyclophilin 27..189 CDD:294131 67/160 (42%)
Ppil1NP_001029360.1 cyclophilin_SpCYP2_like 15..161 CDD:238903 67/159 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2633
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.