DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ninaA and Ppil3

DIOPT Version :9

Sequence 1:NP_476656.1 Gene:ninaA / 33271 FlyBaseID:FBgn0002936 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_783638.1 Gene:Ppil3 / 301432 RGDID:631415 Length:161 Species:Rattus norvegicus


Alignment Length:149 Identity:58/149 - (38%)
Similarity:82/149 - (55%) Gaps:7/149 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 VGRITFGLFGKLAPKTVANFRHICLRGINGTSYVGSRFHRVVDRFLVQGGDIVNGDGTGSISIYG 104
            ||.|...:|.:..|||..||..:|.    ...|.|..|||.:..|:||.|| ..|.|.|..||:|
  Rat     9 VGDIKIEVFCERTPKTCENFLALCA----SNYYNGCVFHRNIKGFMVQTGD-PTGTGRGGSSIWG 68

  Fly   105 DYFPDEDKALAVEHNRPGYLGMANRGPDTNGCQFYVTTVGAKWLDGKHTVFGKVLEGMDTIYAIE 169
            ..|.||.... ::||..|.:.|||.||:|||.||::|......||.|:||||||::|::|:..:|
  Rat    69 KKFEDEYSEY-LKHNVRGVVSMANNGPNTNGSQFFITYGKQPHLDMKYTVFGKVIDGLETLDELE 132

  Fly   170 DVKTDTDDF-PVEPVVISN 187
            .:..:...: |:..|.|.:
  Rat   133 KLPVNEKTYRPLNDVHIKD 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ninaANP_476656.1 cyclophilin 27..189 CDD:294131 58/149 (39%)
Ppil3NP_783638.1 Cyclophilin_PPIL3_like 1..154 CDD:238909 58/149 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.900

Return to query results.
Submit another query.