DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ninaA and Ppif

DIOPT Version :9

Sequence 1:NP_476656.1 Gene:ninaA / 33271 FlyBaseID:FBgn0002936 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_758443.1 Gene:Ppif / 282819 RGDID:628670 Length:206 Species:Rattus norvegicus


Alignment Length:168 Identity:76/168 - (45%)
Similarity:101/168 - (60%) Gaps:14/168 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 IYMDVKHNKKPVGRITFGLFGKLAPKTVANFRHICLRGINGTSYVGSRFHRVVDRFLVQGGDIVN 93
            :|:||..:.:|:||:...|...:.|||..|||.:| .|..|..|.||.||||:..|:.|.||..|
  Rat    47 VYLDVGADGQPLGRVVLELKADVVPKTAENFRALC-TGEKGFGYKGSTFHRVIPAFMCQAGDFTN 110

  Fly    94 GDGTGSISIYGDYFPDEDKALAVEHNRPGYLGMANRGPDTNGCQFYVTTVGAKWLDGKHTVFGKV 158
            .:|||..||||..||||:  ..::|..||.|.|||.||:|||.||::.|:...||||||.|||.|
  Rat   111 HNGTGGKSIYGSRFPDEN--FTLKHVGPGVLSMANAGPNTNGSQFFICTIKTDWLDGKHVVFGHV 173

  Fly   159 LEGMDTIYAIEDV-----KTDTDDFPVEPVVISNCGEI 191
            .||||.:..||..     ||.      :.:||::||::
  Rat   174 KEGMDVVKKIESFGSKSGKTS------KKIVITDCGQL 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ninaANP_476656.1 cyclophilin 27..189 CDD:294131 74/164 (45%)
PpifNP_758443.1 cyclophilin_ABH_like 45..203 CDD:238907 74/164 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.