DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ninaA and Ppia

DIOPT Version :9

Sequence 1:NP_476656.1 Gene:ninaA / 33271 FlyBaseID:FBgn0002936 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_058797.1 Gene:Ppia / 25518 RGDID:3372 Length:164 Species:Rattus norvegicus


Alignment Length:172 Identity:74/172 - (43%)
Similarity:102/172 - (59%) Gaps:14/172 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 VTSRIYMDVKHNKKPVGRITFGLFGKLAPKTVANFRHICLRGINGTSYVGSRFHRVVDRFLVQGG 89
            |...::.|:..:.:|:||:.|.||....|||..|||.:. .|..|..|.||.|||::..|:.|||
  Rat     2 VNPTVFFDITADGEPLGRVCFELFADKVPKTAENFRALS-TGEKGFGYKGSSFHRIIPGFMCQGG 65

  Fly    90 DIVNGDGTGSISIYGDYFPDEDKALAVEHNRPGYLGMANRGPDTNGCQFYVTTVGAKWLDGKHTV 154
            |....:|||..||||:.|.||:  ..::|..||.|.|||.||:|||.||::.|...:||||||.|
  Rat    66 DFTRHNGTGGKSIYGEKFEDEN--FILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVV 128

  Fly   155 FGKVLEGMDTIYAIE-----DVKTDTDDFPVEPVVISNCGEI 191
            ||||.|||..:.|:|     :.||.      :.:.||:||::
  Rat   129 FGKVKEGMSIVEAMERFGSRNGKTS------KKITISDCGQL 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ninaANP_476656.1 cyclophilin 27..189 CDD:294131 71/166 (43%)
PpiaNP_058797.1 cyclophilin_ABH_like 4..162 CDD:238907 71/166 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.