DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ninaA and wis2

DIOPT Version :9

Sequence 1:NP_476656.1 Gene:ninaA / 33271 FlyBaseID:FBgn0002936 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_594787.1 Gene:wis2 / 2542541 PomBaseID:SPAC1B3.03c Length:356 Species:Schizosaccharomyces pombe


Alignment Length:193 Identity:84/193 - (43%)
Similarity:113/193 - (58%) Gaps:26/193 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 YMDVKHNKKPVGRITFGLFGKLAPKTVANFRHICLRGING-------TSYVGSRFHRVVDRFLVQ 87
            |..:..:.|....|.|.||..:.||||.||..:|    ||       .:|.|||||||:..|::|
pombe     6 YFKISIDGKIQPTIYFELFDNVVPKTVKNFASLC----NGFEKDGRCLTYKGSRFHRVIKNFMLQ 66

  Fly    88 GGDIVNGDGTGSISIYGDYFPDEDKALAVEHNRPGYLGMANRGPDTNGCQFYVTTVGAKWLDGKH 152
            |||...|:|||..||||:.|.||:  ..::|::|..|.|||.||:|||.||::|||....|||||
pombe    67 GGDFTRGNGTGGESIYGEKFEDEN--FELKHDKPFLLSMANAGPNTNGSQFFITTVPTPHLDGKH 129

  Fly   153 TVFGKVLEGMDTIYAIEDVKTDTDDFPVEPVVISNCG------------EIPTEQFEFYPDDF 203
            .|||||::|..|:..||:::|..|| ||.||||..||            ::..:..|.:|||:
pombe   130 VVFGKVIQGKSTVRTIENLETKNDD-PVVPVVIEECGTCTKDQIEAPKPDVTGDSLEEFPDDY 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ninaANP_476656.1 cyclophilin 27..189 CDD:294131 78/165 (47%)
wis2NP_594787.1 cyclophilin 6..165 CDD:294131 78/165 (47%)
TPR_11 204..287 CDD:290150
TPR repeat 204..253 CDD:276809
TPR repeat 258..288 CDD:276809
TPR_11 261..323 CDD:290150
TPR repeat 293..323 CDD:276809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.