DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ninaA and ppi1

DIOPT Version :9

Sequence 1:NP_476656.1 Gene:ninaA / 33271 FlyBaseID:FBgn0002936 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_595664.1 Gene:ppi1 / 2540269 PomBaseID:SPBC28F2.03 Length:162 Species:Schizosaccharomyces pombe


Alignment Length:165 Identity:83/165 - (50%)
Similarity:110/165 - (66%) Gaps:4/165 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 SRIYMDVKHNKKPVGRITFGLFGKLAPKTVANFRHICLRGINGTSYVGSRFHRVVDRFLVQGGDI 91
            |..:.||..|.:|:|||.|.||..:.|||.||||.:| .|..|..|.||.||||:.:|::||||.
pombe     2 SNCFFDVIANGQPLGRIVFKLFDDVVPKTAANFRALC-TGEKGYGYAGSTFHRVIPQFMLQGGDF 65

  Fly    92 VNGDGTGSISIYGDYFPDEDKALAVEHNRPGYLGMANRGPDTNGCQFYVTTVGAKWLDGKHTVFG 156
            ..|:|||..||||:.||||:  .|::||:||.|.|||.||:|||.||::|||...||||||.|||
pombe    66 TRGNGTGGKSIYGEKFPDEN--FALKHNKPGLLSMANAGPNTNGSQFFITTVVTPWLDGKHVVFG 128

  Fly   157 KVLEGMDTIYAIEDVKTDTDDFPVEPVVISNCGEI 191
            :|.||||.:..:|.:.:::...... :||..||.:
pombe   129 EVTEGMDVVKKVESLGSNSGATRAR-IVIDKCGTV 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ninaANP_476656.1 cyclophilin 27..189 CDD:294131 81/161 (50%)
ppi1NP_595664.1 cyclophilin_ABH_like 2..160 CDD:238907 81/161 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.