DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ninaA and cyp3

DIOPT Version :9

Sequence 1:NP_476656.1 Gene:ninaA / 33271 FlyBaseID:FBgn0002936 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_595437.1 Gene:cyp3 / 2540198 PomBaseID:SPBC1709.04c Length:173 Species:Schizosaccharomyces pombe


Alignment Length:169 Identity:76/169 - (44%)
Similarity:104/169 - (61%) Gaps:8/169 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 IYMDVKHNKKPVGRITFGLFGKLAPKTVANFRHIC---LRGIN--GTSYVGSRFHRVVDRFLVQG 88
            ::||:..:.:.:|||...||..:.|||..|||..|   ..|:|  ...|..|.|||::..|::||
pombe     7 VFMDIAIDGRLLGRIKIRLFSSIVPKTAENFRQFCTGETLGVNQKPIGYKNSTFHRIIQGFMIQG 71

  Fly    89 GDIVNGDGTGSISIYGD-YFPDEDKALAVEHNRPGYLGMANRGPDTNGCQFYVTTVGAKWLDGKH 152
            ||.|:||||||.:|:.. .||||:  ..::|:|||.|.|||.|.|:|||||::|||...:|||||
pombe    72 GDFVSGDGTGSATIFNSRTFPDEN--FTLKHDRPGLLSMANAGKDSNGCQFFITTVPCDFLDGKH 134

  Fly   153 TVFGKVLEGMDTIYAIEDVKTDTDDFPVEPVVISNCGEI 191
            .|||:|:||.|.:..||......:..|...|.|..|||:
pombe   135 VVFGEVIEGYDIVKEIESTPVGANSRPKSNVAIVECGEM 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ninaANP_476656.1 cyclophilin 27..189 CDD:294131 73/165 (44%)
cyp3NP_595437.1 cyclophilin_ABH_like 5..171 CDD:238907 73/165 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.