DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ninaA and Ppic

DIOPT Version :9

Sequence 1:NP_476656.1 Gene:ninaA / 33271 FlyBaseID:FBgn0002936 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_032934.1 Gene:Ppic / 19038 MGIID:97751 Length:212 Species:Mus musculus


Alignment Length:196 Identity:91/196 - (46%)
Similarity:118/196 - (60%) Gaps:11/196 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LLNRIILCSAF--LAVASGLSF------TVTSRIYMDVKHNKKPVGRITFGLFGKLAPKTVANFR 60
            ||...:||...  |..:||.|.      :||.:::.||:...|.||||..||||.:.||||.||.
Mouse     7 LLLPAVLCLGLGALVSSSGSSGVRKRGPSVTDKVFFDVRIGDKDVGRIVIGLFGNVVPKTVENFV 71

  Fly    61 HICLRGINGTSYVGSRFHRVVDRFLVQGGDIVNGDGTGSISIYGDYFPDEDKALAVEHNRPGYLG 125
            .:. .|..|..|.||.||||:..|::||||....||||.:||||:.||||:  ..::|...|::.
Mouse    72 ALA-TGEKGYGYKGSIFHRVIKDFMIQGGDFTARDGTGGMSIYGETFPDEN--FKLKHYGIGWVS 133

  Fly   126 MANRGPDTNGCQFYVTTVGAKWLDGKHTVFGKVLEGMDTIYAIEDVKTDTDDFPVEPVVISNCGE 190
            |||.||||||.||::|.....||||||.||||||:||..:::||...||..|.|:....|.|.|:
Mouse   134 MANAGPDTNGSQFFITLTKPTWLDGKHVVFGKVLDGMTVVHSIELQATDGHDRPLTDCTIVNSGK 198

  Fly   191 I 191
            |
Mouse   199 I 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ninaANP_476656.1 cyclophilin 27..189 CDD:294131 79/161 (49%)
PpicNP_032934.1 cyclophilin_ABH_like 38..197 CDD:238907 79/161 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11071
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.880

Return to query results.
Submit another query.