DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ninaA and cyn-8

DIOPT Version :9

Sequence 1:NP_476656.1 Gene:ninaA / 33271 FlyBaseID:FBgn0002936 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_509507.1 Gene:cyn-8 / 181136 WormBaseID:WBGene00000884 Length:447 Species:Caenorhabditis elegans


Alignment Length:169 Identity:84/169 - (49%)
Similarity:115/169 - (68%) Gaps:7/169 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 RIYMDVKHNKKPVGRITFGLFGKLAPKTVANFRHIC---LRGING--TSYVGSRFHRVVDRFLVQ 87
            |.:.|:..|.:|.|||.|.|:....|:||.|||..|   |..:||  .||.||.||||:..|::|
 Worm    10 RAFFDISINGEPAGRIVFSLWNHCCPRTVENFRAFCTGELGKMNGHYASYQGSVFHRVIKGFMIQ 74

  Fly    88 GGDIVNGDGTGSISIYGDYFPDEDKALAVEHNRPGYLGMANRGPDTNGCQFYVTTVGAKWLDGKH 152
            ||||.:|:|||..||||..|.||:  ||::|.:|..|.||||||||||.||::|:.....|||||
 Worm    75 GGDITHGNGTGGYSIYGRTFDDEN--LALKHKKPYLLSMANRGPDTNGSQFFITSEEVPHLDGKH 137

  Fly   153 TVFGKVLEGMDTIYAIEDVKTDTDDFPVEPVVISNCGEI 191
            .|||:|::|::.:.|||:::|..:|.||..|.|::|||:
 Worm   138 CVFGEVIKGVEVVKAIENLETGNEDKPVCKVEITHCGEM 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ninaANP_476656.1 cyclophilin 27..189 CDD:294131 81/165 (49%)
cyn-8NP_509507.1 cyclophilin 10..174 CDD:412213 81/165 (49%)
ATP-synt_Fo_b <324..391 CDD:349951
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.