DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ninaA and cyn-7

DIOPT Version :9

Sequence 1:NP_476656.1 Gene:ninaA / 33271 FlyBaseID:FBgn0002936 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_506749.1 Gene:cyn-7 / 180027 WormBaseID:WBGene00000883 Length:171 Species:Caenorhabditis elegans


Alignment Length:170 Identity:72/170 - (42%)
Similarity:105/170 - (61%) Gaps:9/170 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 RIYMDVKHNKKPVGRITFGLFGKLAPKTVANFRHICL--RGINGTS----YVGSRFHRVVDRFLV 86
            |::.|:....||.|||...|:..:.|||..|||.:|.  :|:..:.    :.||:|||::..|::
 Worm     5 RVFFDITIAGKPTGRIVMELYNDIVPKTAENFRALCTGEKGVGKSGKPLHFKGSKFHRIIPEFMI 69

  Fly    87 QGGDIVNGDGTGSISIYGDYFPDEDKALAVEHNRPGYLGMANRGPDTNGCQFYVTTVGAKWLDGK 151
            ||||...|:|||..||||:.||||:  ...:|..||.|.|||.||:|||.||::.||...|||||
 Worm    70 QGGDFTRGNGTGGESIYGEKFPDEN--FKEKHTGPGVLSMANAGPNTNGSQFFLCTVKTAWLDGK 132

  Fly   152 HTVFGKVLEGMDTIYAIEDVKTDTDDFPVEPVVISNCGEI 191
            |.|||:|:||:|.:..:|. ...:...|....:|::||::
 Worm   133 HVVFGRVVEGLDIVSKVEG-NGSSSGTPKSECLIADCGQL 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ninaANP_476656.1 cyclophilin 27..189 CDD:294131 70/166 (42%)
cyn-7NP_506749.1 cyclophilin_ABH_like 4..169 CDD:238907 70/166 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.