Sequence 1: | NP_476656.1 | Gene: | ninaA / 33271 | FlyBaseID: | FBgn0002936 | Length: | 237 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_506561.1 | Gene: | cyn-1 / 179936 | WormBaseID: | WBGene00000877 | Length: | 192 | Species: | Caenorhabditis elegans |
Alignment Length: | 200 | Identity: | 80/200 - (40%) |
---|---|---|---|
Similarity: | 114/200 - (56%) | Gaps: | 14/200 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MKSLLNRIILCSAFLAVASGLSFTVTSRIYMDVKHNKKPVGRITFGLFGKLAPKTVANFRHICL- 64
Fly 65 -RGIN----GTSYVGSRFHRVVDRFLVQGGDIVNGDGTGSISIYGDYFPDEDKALAVEHNRPGYL 124
Fly 125 GMANRGPDTNGCQFYVTTVGAKWLDGKHTVFGKVLEGMDTIYAIEDVKTDTDDFPVEPVVISNCG 189
Fly 190 EIPTE 194 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
ninaA | NP_476656.1 | cyclophilin | 27..189 | CDD:294131 | 68/167 (41%) |
cyn-1 | NP_506561.1 | cyclophilin_ABH_like | 22..187 | CDD:238907 | 68/167 (41%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0652 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1403619at2759 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0000032 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.820 |