DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ninaA and cyn-6

DIOPT Version :9

Sequence 1:NP_476656.1 Gene:ninaA / 33271 FlyBaseID:FBgn0002936 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_497257.1 Gene:cyn-6 / 175231 WormBaseID:WBGene00000882 Length:201 Species:Caenorhabditis elegans


Alignment Length:193 Identity:94/193 - (48%)
Similarity:124/193 - (64%) Gaps:5/193 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KSLLNRIILCSAFLAVASGLSFTVTSRIYMDVKHNKKPVGRITFGLFGKLAPKTVANFRHICLRG 66
            ::||..::...|..|.|.|.  .||.:::.|::...:|||:|..||||::.||||.||..:..|.
 Worm     3 RALLFFVLAILALSAEARGP--RVTDKVFFDMEIGGRPVGKIVIGLFGEVVPKTVKNFVELAQRA 65

  Fly    67 INGTSYVGSRFHRVVDRFLVQGGDIVNGDGTGSISIYGDYFPDEDKALAVEHNRPGYLGMANRGP 131
             .|..||||:||||::.|::||||...|||||..||||:.|.||:  ..::|..||:|.|||.|.
 Worm    66 -EGEGYVGSKFHRVIENFMIQGGDFTRGDGTGGRSIYGERFEDEN--FKLQHYGPGWLSMANAGE 127

  Fly   132 DTNGCQFYVTTVGAKWLDGKHTVFGKVLEGMDTIYAIEDVKTDTDDFPVEPVVISNCGEIPTE 194
            ||||.||::||....||||||.||||:|||||.:..||.......|.|:|.|||:|.|.||.|
 Worm   128 DTNGSQFFITTAKTSWLDGKHVVFGKILEGMDVVREIEATPKGAGDRPIEDVVIANAGHIPVE 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ninaANP_476656.1 cyclophilin 27..189 CDD:294131 82/161 (51%)
cyn-6NP_497257.1 cyclophilin 26..185 CDD:294131 82/161 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11071
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.