DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ninaA and cyn-16

DIOPT Version :9

Sequence 1:NP_476656.1 Gene:ninaA / 33271 FlyBaseID:FBgn0002936 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_496562.3 Gene:cyn-16 / 174843 WormBaseID:WBGene00000892 Length:483 Species:Caenorhabditis elegans


Alignment Length:139 Identity:59/139 - (42%)
Similarity:76/139 - (54%) Gaps:9/139 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 GRITFGLFGKLAPKTVANFRHICLRGINGTSYVGSRFHRVVDRFLVQGGDIVNGDGTGSISIYGD 105
            |.|...|:.|.||....||..:|:...    |.|:.|||:|..|::|||| ....|||..||||.
 Worm    22 GDIEIELWTKEAPLACRNFIQLCMENY----YKGTVFHRLVKNFILQGGD-PTATGTGGESIYGK 81

  Fly   106 YFPDEDKALAVEHNRPGYLGMANRGPDTNGCQFYVT--TVGAKWLDGKHTVFGKVL-EGMDTIYA 167
            .|.||... .::.||.|.:||||.|.|.||.||:.|  ..||..||.|||:||||. ..:..:..
 Worm    82 PFKDEIHQ-RLKFNRRGIVGMANAGRDDNGSQFFFTIGDRGAPELDKKHTIFGKVTGPTLFNMLK 145

  Fly   168 IEDVKTDTD 176
            |.:|:|:.|
 Worm   146 ITEVETEGD 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ninaANP_476656.1 cyclophilin 27..189 CDD:294131 59/139 (42%)
cyn-16NP_496562.3 cyclophilin_CeCYP16-like 8..175 CDD:238906 59/139 (42%)
PRK14906 258..>353 CDD:184899
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.