Sequence 1: | NP_476656.1 | Gene: | ninaA / 33271 | FlyBaseID: | FBgn0002936 | Length: | 237 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_496337.1 | Gene: | cyn-4 / 174674 | WormBaseID: | WBGene00000880 | Length: | 523 | Species: | Caenorhabditis elegans |
Alignment Length: | 201 | Identity: | 70/201 - (34%) |
---|---|---|---|
Similarity: | 100/201 - (49%) | Gaps: | 27/201 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 17 VASGLSFTVTSRI--------------YMDVKHNK-----KPVGRITFGLFGKLAPKTVANFRHI 62
Fly 63 CLRGINGTSYVGSRFHRVVDRFLVQGGDIVNGDGTGSISIYGDYFPDEDKALAVEHNRPGYLGMA 127
Fly 128 NRGPDTNGCQFYVTTVGAKWLDGKHTVFGKVLEGMDTIYAIEDVKTDT-DDFPVEPVVISNCGEI 191
Fly 192 PTEQFE 197 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
ninaA | NP_476656.1 | cyclophilin | 27..189 | CDD:294131 | 62/181 (34%) |
cyn-4 | NP_496337.1 | Ubox | 45..96 | CDD:128780 | |
cyclophilin_RING | 281..440 | CDD:238904 | 61/166 (37%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0652 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |