DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ninaA and cyn-5

DIOPT Version :9

Sequence 1:NP_476656.1 Gene:ninaA / 33271 FlyBaseID:FBgn0002936 Length:237 Species:Drosophila melanogaster
Sequence 2:NP_001379232.1 Gene:cyn-5 / 173374 WormBaseID:WBGene00000881 Length:204 Species:Caenorhabditis elegans


Alignment Length:202 Identity:93/202 - (46%)
Similarity:121/202 - (59%) Gaps:17/202 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKSLLNRIILCSAFLAV--------ASGLSFTVTSRIYMDVKHNKKPVGRITFGLFGKLAPKTVA 57
            |||||    :.:|.|||        |.|..  ||.::|.|::...||:|||..|||||..|||..
 Worm     1 MKSLL----VVAAVLAVGALAQGDDAKGPK--VTDKVYFDMEIGGKPIGRIVIGLFGKTVPKTAT 59

  Fly    58 NFRHICLRGINGTSYVGSRFHRVVDRFLVQGGDIVNGDGTGSISIYGDYFPDEDKALAVEHNRPG 122
            ||..:..:. .|..|.||:||||:..|::||||...|||||..||||:.|.||:  ..::|...|
 Worm    60 NFIELAKKP-KGEGYPGSKFHRVIADFMIQGGDFTRGDGTGGRSIYGEKFADEN--FKLKHYGAG 121

  Fly   123 YLGMANRGPDTNGCQFYVTTVGAKWLDGKHTVFGKVLEGMDTIYAIEDVKTDTDDFPVEPVVISN 187
            :|.|||.|.||||.||::|||...||||:|.||||:|||||.:..||..:....|.|.:.|:|:.
 Worm   122 WLSMANAGADTNGSQFFITTVKTPWLDGRHVVFGKILEGMDVVRKIEQTEKLPGDRPKQDVIIAA 186

  Fly   188 CGEIPTE 194
            .|.|..:
 Worm   187 SGHIAVD 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ninaANP_476656.1 cyclophilin 27..189 CDD:294131 78/161 (48%)
cyn-5NP_001379232.1 cyclophilin 29..188 CDD:412213 78/161 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11071
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.