DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ninaA and LOC100909955

DIOPT Version :9

Sequence 1:NP_476656.1 Gene:ninaA / 33271 FlyBaseID:FBgn0002936 Length:237 Species:Drosophila melanogaster
Sequence 2:XP_038936344.1 Gene:LOC100909955 / 100909955 RGDID:6501070 Length:187 Species:Rattus norvegicus


Alignment Length:188 Identity:67/188 - (35%)
Similarity:101/188 - (53%) Gaps:18/188 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 IILCSAFLAVASGLSFTVTSRIYMDVKHNKKPVGRITFGLFGKLAPKTVANFRHICLRGINGTSY 72
            |.:| .|..:|:.|   |...:|.::..:.:|:|.::|.||....|||..|| |....|..|..|
  Rat    12 IAVC-CFSPLAAEL---VNPTVYFNITADGEPLGHVSFELFADNVPKTAENF-HALSTGEKGFGY 71

  Fly    73 VGSRFHRVVDRFLVQGGDIVNGDGTGSISIYGDYFPDEDKALAVEHNRPGYLGMANRGPDTNGCQ 137
            ..|.|||::..|:.|||::...:|.|..|||.:.|..||  :.::|..||.|.|||..|:|:|.|
  Rat    72 KASSFHRIIPGFMCQGGNVTCHNGAGGRSIYREKFEGED--VILKHTGPGILSMANDEPNTSGSQ 134

  Fly   138 FYVTTVGAKWLDGKHTVFGKVLEGMDTIYAIE-----DVKTDTDDFPVEPVVISNCGE 190
            |::.|...:||.||..||.|..:||:.:.|:|     :.||.      :.:.||.||:
  Rat   135 FFICTAKTEWLGGKGVVFEKAKDGMNIVEAMERFGSRNGKTS------KQITISGCGQ 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ninaANP_476656.1 cyclophilin 27..189 CDD:294131 59/166 (36%)
LOC100909955XP_038936344.1 cyclophilin 27..185 CDD:412213 59/166 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.