DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ninaA and ppil6

DIOPT Version :9

Sequence 1:NP_476656.1 Gene:ninaA / 33271 FlyBaseID:FBgn0002936 Length:237 Species:Drosophila melanogaster
Sequence 2:XP_017949805.1 Gene:ppil6 / 100496026 XenbaseID:XB-GENE-979458 Length:304 Species:Xenopus tropicalis


Alignment Length:168 Identity:70/168 - (41%)
Similarity:99/168 - (58%) Gaps:11/168 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 IYMDVKHNKKPVGRITFGLFGKLAPKTVANFRHICLRGINGTS-------YVGSRFHRVVDRFLV 86
            :|:|:....|||||:.|.||..|.|||..||:.:| .|..|.|       |..|.|||:|....:
 Frog   137 VYLDISIQGKPVGRLLFELFSDLCPKTCENFQSLC-TGAAGVSLSGLKLHYKDSIFHRIVKNGWI 200

  Fly    87 QGGDIVNGDGTGSISIYGDYFPDEDKALAVEHNRPGYLGMANRGPDTNGCQFYVTTVGAKWLDGK 151
            |||||.:|.|:|..||:|:.|.||:  .||.|::.|.|||||:|..:||.|||:|.....:||.:
 Frog   201 QGGDIESGKGSGGESIFGETFEDEN--FAVPHSKRGILGMANKGRHSNGSQFYITLQPTSYLDRR 263

  Fly   152 HTVFGKVLEGMDTIYAIEDVKTDTDDFPVEPVVISNCG 189
            ...||:::||...:..|||:.| .::.|.....|::||
 Frog   264 CVAFGQLVEGCGVLKEIEDIPT-YNERPTTDCKITDCG 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ninaANP_476656.1 cyclophilin 27..189 CDD:294131 68/166 (41%)
ppil6XP_017949805.1 cyclophilin 137..300 CDD:381853 68/166 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.