DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ninaA and ppic

DIOPT Version :9

Sequence 1:NP_476656.1 Gene:ninaA / 33271 FlyBaseID:FBgn0002936 Length:237 Species:Drosophila melanogaster
Sequence 2:XP_002931773.2 Gene:ppic / 100494684 XenbaseID:XB-GENE-948735 Length:208 Species:Xenopus tropicalis


Alignment Length:180 Identity:87/180 - (48%)
Similarity:117/180 - (65%) Gaps:4/180 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 VTSRIYMDVKHNKKPVGRITFGLFGKLAPKTVANFRHICLRGINGTSYVGSRFHRVVDRFLVQGG 89
            ||::::.:|:......|||..|||||:.||||.||..:. .|..|..|.|||||||:..|::|||
 Frog    30 VTAKVFFNVEIGGTDAGRIVIGLFGKVVPKTVKNFVALA-TGEKGYGYKGSRFHRVIKDFMIQGG 93

  Fly    90 DIVNGDGTGSISIYGDYFPDEDKALAVEHNRPGYLGMANRGPDTNGCQFYVTTVGAKWLDGKHTV 154
            |:.||||||..||||:.||||:  ..::|...|::.|||.||||||.||:::|....||:|||.|
 Frog    94 DVTNGDGTGGKSIYGETFPDEN--FKLKHYGIGWVSMANAGPDTNGSQFFISTTRPLWLNGKHVV 156

  Fly   155 FGKVLEGMDTIYAIEDVKTDTDDFPVEPVVISNCGEIPT-EQFEFYPDDF 203
            ||||||||..::.||..:|:..|.|::..||.|.|.:.. |.|....||:
 Frog   157 FGKVLEGMAVVHLIELQQTNERDQPLKDCVIVNSGVVTVKEPFVVEVDDW 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ninaANP_476656.1 cyclophilin 27..189 CDD:294131 80/161 (50%)
ppicXP_002931773.2 cyclophilin 33..191 CDD:294131 80/160 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11071
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.