DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ninaA and Nktr

DIOPT Version :9

Sequence 1:NP_476656.1 Gene:ninaA / 33271 FlyBaseID:FBgn0002936 Length:237 Species:Drosophila melanogaster
Sequence 2:XP_038938667.1 Gene:Nktr / 100364165 RGDID:2321593 Length:1516 Species:Rattus norvegicus


Alignment Length:172 Identity:78/172 - (45%)
Similarity:105/172 - (61%) Gaps:9/172 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 YMDVKHNKKPVGRITFGLFGKLAPKTVANFRHICL--RGINGTS-----YVGSRFHRVVDRFLVQ 87
            :.|::.|::|||||.|.||..:.|||..||..:|.  :|:..|:     |.||.|||||..|::|
  Rat    69 HFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLGKTTGKKLCYKGSTFHRVVKNFMIQ 133

  Fly    88 GGDIVNGDGTGSISIYGDYFPDEDKALAVEHNRPGYLGMANRGPDTNGCQFYVTTVGAKWLDGKH 152
            |||...|:|.|..||||.||.||:  ..::|:|...|.|||||..|||.||::||..|..|||.|
  Rat   134 GGDFSEGNGKGGESIYGGYFKDEN--FILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVH 196

  Fly   153 TVFGKVLEGMDTIYAIEDVKTDTDDFPVEPVVISNCGEIPTE 194
            .|||.|:.|.:.|..||::|||....|...|.:.:||.:.|:
  Rat   197 VVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGVLATK 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ninaANP_476656.1 cyclophilin 27..189 CDD:294131 75/165 (45%)
NktrXP_038938667.1 cyclophilin 66..233 CDD:412213 75/165 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.