DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment aru and eps8b

DIOPT Version :9

Sequence 1:NP_722663.1 Gene:aru / 33268 FlyBaseID:FBgn0029095 Length:805 Species:Drosophila melanogaster
Sequence 2:XP_021323458.1 Gene:eps8b / 564779 ZFINID:ZDB-GENE-060503-164 Length:239 Species:Danio rerio


Alignment Length:126 Identity:40/126 - (31%)
Similarity:53/126 - (42%) Gaps:20/126 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   676 MLESWLEDLQATGAKIVLVTYPRTANNDKELSVMRGEYLEILDDTRKWWKARNMRGQVAHVPHTI 740
            |||....|||.     |.:.|...|.|..||:|.:|:.||:|::.::||..||..||..:||..:
Zfish     1 MLEPSNSDLQH-----VRIRYHFVARNANELTVQQGDELEVLENNQQWWLLRNRSGQSGYVPCNV 60

  Fly   741 ---VTPFNFGDGDGAQFYGQQQQPPTGPTG---PGN---------KSRSGDNPGMEQRSPD 786
               |.|........|.|..|...|..|.|.   |.|         .||..||...::...|
Zfish    61 LEEVKPEEQQYNRAALFSSQAVNPYKGTTTSPVPVNHAVVLEMNKSSRDKDNRDQQKEVND 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aruNP_722663.1 PTB_EPS8 82..215 CDD:269921
SH3_Eps8 691..744 CDD:212698 20/55 (36%)
eps8bXP_021323458.1 SH3 12..64 CDD:327375 19/51 (37%)
SAM_EPS8-like 150..214 CDD:188939
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586353
Domainoid 1 1.000 56 1.000 Domainoid score I10958
eggNOG 1 0.900 - - E1_KOG3557
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D118943at33208
OrthoFinder 1 1.000 - - FOG0001461
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.