DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13950 and si:dkey-95h12.1

DIOPT Version :9

Sequence 1:NP_001334728.1 Gene:CG13950 / 33267 FlyBaseID:FBgn0031289 Length:316 Species:Drosophila melanogaster
Sequence 2:XP_001334297.2 Gene:si:dkey-95h12.1 / 794350 ZFINID:ZDB-GENE-060503-85 Length:754 Species:Danio rerio


Alignment Length:161 Identity:32/161 - (19%)
Similarity:47/161 - (29%) Gaps:70/161 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 MCPD--KVAFQSDVPRRYETGTVVAMEC------------------------------IAKGPPT 190
            :|||  :..|..|.|.  |...|:.:.|                              ::|||. 
Zfish   595 VCPDPAQQTFLYDAPE--EKPRVLTVPCEYLLDNGVYNMMIITINGKVNADANQFVVDLSKGPD- 656

  Fly   191 TEFSICFQCNDTGRTVLRFHVNFDRTTVSRSYQREDN----------SFALSDEETEGEFPFVRG 245
                            :..||||       |:..:.|          |....:|.....|.|.||
Zfish   657 ----------------IACHVNF-------SFSEDGNPRIGCNSLIGSIWGKEERGVSSFHFFRG 698

  Fly   246 KLFKIAFGLGDRAFLIAVNGQYFTYYNFPGR 276
            ..|::.....:..|.:.|||.:.  .||..|
Zfish   699 MPFEMKILCTNTEFQVTVNGSHL--MNFKHR 727

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13950NP_001334728.1 None
si:dkey-95h12.1XP_001334297.2 FN3 501..592 CDD:238020
Gal-bind_lectin 626..749 CDD:214904 23/128 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3587
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.