DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13950 and Grifin

DIOPT Version :9

Sequence 1:NP_001334728.1 Gene:CG13950 / 33267 FlyBaseID:FBgn0031289 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_084298.1 Gene:Grifin / 77998 MGIID:1925248 Length:144 Species:Mus musculus


Alignment Length:133 Identity:32/133 - (24%)
Similarity:47/133 - (35%) Gaps:40/133 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 GHVLIVSGRVKPHPNKISLD-LTDNVNAQNESETVFLKIEANFREGQIIRSMFQPGGGWQQEEIS 78
            |..|.|.|.......|..:: |||       :..:...::..|....::.:.|| ||.|.|||:|
Mouse    16 GWSLTVQGHADAGEEKFEINFLTD-------AGDIAFHVKPRFSSATVVGNAFQ-GGRWGQEEVS 72

  Fly    79 KNWKCDGPKNPLQPGQSFTFRVAVLQRCFEIYVNDQLYGSFEFVKFPKQINYVRTYGDFEKITQF 143
            ..:       ||..|:.|...|:.....|.||..:|                        |:.||
Mouse    73 SIF-------PLTLGEPFEMEVSADAEHFHIYAQEQ------------------------KVLQF 106

  Fly   144 HHR 146
            .||
Mouse   107 PHR 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13950NP_001334728.1 None
GrifinNP_084298.1 GLECT 5..132 CDD:214596 32/133 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3587
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11346
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.960

Return to query results.
Submit another query.