DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13950 and LGALS14

DIOPT Version :10

Sequence 1:NP_608553.1 Gene:CG13950 / 33267 FlyBaseID:FBgn0031289 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_982297.1 Gene:LGALS14 / 56891 HGNCID:30054 Length:168 Species:Homo sapiens


Alignment Length:105 Identity:24/105 - (22%)
Similarity:43/105 - (40%) Gaps:18/105 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   189 PTTEFSICFQCNDTGRTVLRFHVNFDRTTVSRS-----YQREDNSFALSDEETEGEFPFVRGKLF 248
            |..|.:.....::......:|.::|....:..|     ::.|:..:.|         ||..||.|
Human    63 PQLEVNFYTGMDEDSDIAFQFRLHFGHPAIMNSCVFGIWRYEEKCYYL---------PFEDGKPF 118

  Fly   249 KIAFGLGDRAFLIAVNGQYFTYYNFPGR--PFSISTLKCF 286
            ::...:..:.:.:.||||  ..|||..|  |.|:..|:.|
Human   119 ELCIYVRHKEYKVMVNGQ--RIYNFAHRFPPASVKMLQVF 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13950NP_608553.1 Gal-bind_lectin 10..144 CDD:459768
Gal-bind_lectin 170..299 CDD:459768 24/105 (23%)
LGALS14NP_982297.1 Gal-bind_lectin 40..165 CDD:459768 24/105 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.