DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13950 and si:ch211-10a23.2

DIOPT Version :9

Sequence 1:NP_001334728.1 Gene:CG13950 / 33267 FlyBaseID:FBgn0031289 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001139237.1 Gene:si:ch211-10a23.2 / 567812 ZFINID:ZDB-GENE-090313-9 Length:149 Species:Danio rerio


Alignment Length:125 Identity:30/125 - (24%)
Similarity:55/125 - (44%) Gaps:11/125 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LIVSGRVKPHPNKISLDLTDNVNAQNESE---TVFLKIEANFREGQIIRSMFQPGGGWQQEEISK 79
            |||.|.|...|..:.:.::.....:.:.|   .|.|:::.||.|..::|:. :..|.|...|.:.
Zfish    27 LIVMGIVHKQPKSMVVIVSCQSKGEGDEEIEGDVGLELKVNFPEKAVLRNA-RLSGKWGSSETAL 90

  Fly    80 NWKCDGPKNPLQPGQSFTFRVAVLQRCFEIYVNDQ-LYGSFEFVKFPKQINYVRTYGDFE 138
            ::      .|..||::|...:....:.|.|.|:.| |.|..........:|.:|.:||.:
Zfish    91 SF------FPFAPGEAFKMEIVCEHQQFRILVDGQPLCGFAHRQTQLASLNALRVHGDLQ 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13950NP_001334728.1 None
si:ch211-10a23.2NP_001139237.1 Gal-bind_lectin 19..148 CDD:214904 30/125 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3587
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11346
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.