DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13950 and lgals3a

DIOPT Version :10

Sequence 1:NP_608553.1 Gene:CG13950 / 33267 FlyBaseID:FBgn0031289 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001373725.1 Gene:lgals3a / 557373 ZFINID:ZDB-GENE-030131-7667 Length:368 Species:Danio rerio


Alignment Length:72 Identity:24/72 - (33%)
Similarity:33/72 - (45%) Gaps:17/72 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   208 RFHVNFDR--------------TTVSRSYQREDNSFALSDEETEGEFPFVRGKLFKIAFGLGDRA 258
            ||||:|.|              .||.|:.|.   ......||.||.||||:|:.|::...:....
Zfish   265 RFHVDFMRGHEVVFHFNPRFHENTVVRNSQL---GGLWGPEEREGGFPFVQGRQFELKILVETDG 326

  Fly   259 FLIAVNG 265
            |.:||:|
Zfish   327 FKVAVDG 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13950NP_608553.1 Gal-bind_lectin 10..144 CDD:459768
Gal-bind_lectin 170..299 CDD:459768 24/72 (33%)
lgals3aNP_001373725.1 PRK07764 <11..158 CDD:236090
Gal-bind_lectin 246..362 CDD:214904 24/72 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.