powered by:
Protein Alignment CG13950 and lgals3a
DIOPT Version :9
Sequence 1: | NP_001334728.1 |
Gene: | CG13950 / 33267 |
FlyBaseID: | FBgn0031289 |
Length: | 316 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001373725.1 |
Gene: | lgals3a / 557373 |
ZFINID: | ZDB-GENE-030131-7667 |
Length: | 368 |
Species: | Danio rerio |
Alignment Length: | 72 |
Identity: | 24/72 - (33%) |
Similarity: | 33/72 - (45%) |
Gaps: | 17/72 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 208 RFHVNFDR--------------TTVSRSYQREDNSFALSDEETEGEFPFVRGKLFKIAFGLGDRA 258
||||:|.| .||.|:.|. ......||.||.||||:|:.|::...:....
Zfish 265 RFHVDFMRGHEVVFHFNPRFHENTVVRNSQL---GGLWGPEEREGGFPFVQGRQFELKILVETDG 326
Fly 259 FLIAVNG 265
|.:||:|
Zfish 327 FKVAVDG 333
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG13950 | NP_001334728.1 |
None |
lgals3a | NP_001373725.1 |
PRK07764 |
<11..158 |
CDD:236090 |
|
Gal-bind_lectin |
246..362 |
CDD:214904 |
24/72 (33%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3587 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR11346 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.000 |
|
Return to query results.
Submit another query.