DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13950 and F38A1.15

DIOPT Version :9

Sequence 1:NP_001334728.1 Gene:CG13950 / 33267 FlyBaseID:FBgn0031289 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001076689.1 Gene:F38A1.15 / 4927004 WormBaseID:WBGene00044908 Length:319 Species:Caenorhabditis elegans


Alignment Length:169 Identity:38/169 - (22%)
Similarity:63/169 - (37%) Gaps:45/169 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 DVPRRYETGTVVAMECIAKGPP-------TTEF---SICFQCNDTGRTVLRFHVNFDRTTVSRSY 222
            |:|..|.|        |:|..|       |::|   |..|.......:..||.::| ..|::|.|
 Worm   147 DIPDTYTT--------ISKTVPQPYYHYLTSKFLPGSTFFMTGQISSSQHRFTISF-YNTITRFY 202

  Fly   223 -------------QREDNSFALSDE-----ETEGEFPFVRGKLFKIAFGLG-DRAFLIAVNGQYF 268
                         |...|.:..:..     :|| :.|:..|:.|||..... ..||:...|....
 Worm   203 PLYVEVRNFIGSGQTALNMYTYNGNTRIKVQTE-KSPYTYGETFKIYVNSSYTEAFIYLDNNAII 266

  Fly   269 TYYNFPGRPFSISTLKCF----TNEVGDFAVRSLEYHSD 303
            |:....|  ::::.:..|    |||..:.|:..|.:..|
 Worm   267 THELVEG--YNMTDIDSFVINITNESTEVALDFLGWTGD 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13950NP_001334728.1 None
F38A1.15NP_001076689.1 CW 23..110 CDD:214742
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3587
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.