DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13950 and lgals2a

DIOPT Version :10

Sequence 1:NP_608553.1 Gene:CG13950 / 33267 FlyBaseID:FBgn0031289 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_998059.2 Gene:lgals2a / 405830 ZFINID:ZDB-GENE-050318-2 Length:134 Species:Danio rerio


Alignment Length:124 Identity:28/124 - (22%)
Similarity:52/124 - (41%) Gaps:31/124 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   173 YETGTVVAMECIAKGPPTTEFSICFQCNDTGRTV--LRFHVN--FDR-----TTVSRSYQREDNS 228
            ::.|..:.:..:.| |.:|.|:|     :.|.:.  :..|:|  ||.     |.|..|:|    |
Zfish    11 FKVGQTLTITGVPK-PDSTNFAI-----NIGHSPEDIALHMNPRFDAHGDQCTIVCNSFQ----S 65

  Fly   229 FALSDEETEGEFPFVRGKLFKIAFGLGDRAFLIAV------------NGQYFTYYNFPG 275
            .:..:|..:..|||::.|.|:|.....:..||:.:            ..:.:.|.:|.|
Zfish    66 GSWCEEHRDNNFPFIQDKEFQIKITFTNEEFLVTLPDGSEIHFPNRQGSEKYKYMHFEG 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13950NP_608553.1 Gal-bind_lectin 10..144 CDD:459768
Gal-bind_lectin 170..299 CDD:459768 28/124 (23%)
lgals2aNP_998059.2 GLECT 10..132 CDD:238025 28/124 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.