DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13950 and GRIFIN

DIOPT Version :10

Sequence 1:NP_608553.1 Gene:CG13950 / 33267 FlyBaseID:FBgn0031289 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001381716.1 Gene:GRIFIN / 402635 HGNCID:4577 Length:144 Species:Homo sapiens


Alignment Length:111 Identity:24/111 - (21%)
Similarity:43/111 - (38%) Gaps:19/111 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 GHVLIVSGRVKPHPNKISLDLTDNVNAQNESETVFLKIEANFREGQIIRSMFQPGGGWQQEEISK 79
            |..|:|.|......::.      ..|...|:..:...|:..|....::.:.|| .|.|..|::|.
Human    16 GWKLLVQGHADSGEDRF------ETNFLLETGDIAFHIKPRFSSATVVGNAFQ-YGRWGPEQVSS 73

  Fly    80 NWKCDGPKNPLQPGQSFTFRVAVLQRCFEIYVNDQLYGSFEFVKFP 125
            .:       ||.||:.|...|:.....|.:|..:.     :.::||
Human    74 IF-------PLAPGEPFEIEVSWDAEHFHVYAPEH-----KVLQFP 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13950NP_608553.1 Gal-bind_lectin 10..144 CDD:459768 24/111 (22%)
Gal-bind_lectin 170..299 CDD:459768
GRIFINNP_001381716.1 Gal-bind_lectin 11..131 CDD:214904 24/111 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.