DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13950 and LGALS9

DIOPT Version :9

Sequence 1:NP_001334728.1 Gene:CG13950 / 33267 FlyBaseID:FBgn0031289 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_033665.1 Gene:LGALS9 / 3965 HGNCID:6570 Length:355 Species:Homo sapiens


Alignment Length:375 Identity:92/375 - (24%)
Similarity:126/375 - (33%) Gaps:139/375 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VPFGHVLIVSGRVKPHPNKISLDLTDNVNAQNESETVFLKIEANFR---EGQIIRSMFQP---GG 70
            |||...  :.|.::.     .|.:|.|....:.|.|.|   ..||:   .|..|...|.|   .|
Human    15 VPFSGT--IQGGLQD-----GLQITVNGTVLSSSGTRF---AVNFQTGFSGNDIAFHFNPRFEDG 69

  Fly    71 GWQQEEISKN--WKCDGPKN-----PLQPGQSFTFRVAVLQRCFEIYVNDQLYGS-FEFVKFPK- 126
            |:......:|  |   ||:.     |.|.|..|.....|....|::.||..|:.. |..|.|.: 
Human    70 GYVVCNTRQNGSW---GPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFVQYFHRVPFHRV 131

  Fly   127 ---------QINYVRTYGDFEKITQFHHRMLFPLVFPRTLMCPDKVAFQSDVP------------ 170
                     |::|:    .|:.              |||:  |.:.|| |.||            
Human   132 DTISVNGSVQLSYI----SFQN--------------PRTV--PVQPAF-STVPFSQPVCFPPRPR 175

  Fly   171 -RRYE------------TGTVVAMECIAKG--------PP-------------TTEFSICFQCND 201
             ||.:            |.||:.....|.|        ||             ||.....:....
Human   176 GRRQKPPGVWPANPAPITQTVIHTVQSAPGQMFSTPAIPPMMYPHPAYPMPFITTILGGLYPSKS 240

  Fly   202 --TGRTVL----RFHVN--------------FDRTTVSRSYQREDNSFALSDEETEGEFPFVRGK 246
              ...|||    |||:|              ||...|.|:.| .|||:...:.....:.|||||:
Human   241 ILLSGTVLPSAQRFHINLCSGNHIAFHLNPRFDENAVVRNTQ-IDNSWGSEERSLPRKMPFVRGQ 304

  Fly   247 LFKIAFGLGDRAFLIAVNGQY-FTYY----NFPGRPFSISTLKCFTNEVG 291
            .|.:..........:||:||: |.||    |.|    :|:.|     |||
Human   305 SFSVWILCEAHCLKVAVDGQHLFEYYHRLRNLP----TINRL-----EVG 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13950NP_001334728.1 None
LGALS9NP_033665.1 lectin domain 1..148 36/149 (24%)
GLECT 16..146 CDD:238025 35/146 (24%)
alternate exon 149..180 11/47 (23%)
Peptidase_C62 <154..214 CDD:289173 13/60 (22%)
link peptide 181..206 4/24 (17%)
lectin domain 207..355 39/149 (26%)
Gal-bind_lectin 233..354 CDD:214904 35/123 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165150756
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3587
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11346
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.