DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13950 and LGALS7

DIOPT Version :10

Sequence 1:NP_608553.1 Gene:CG13950 / 33267 FlyBaseID:FBgn0031289 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_002298.1 Gene:LGALS7 / 3963 HGNCID:6568 Length:136 Species:Homo sapiens


Alignment Length:136 Identity:35/136 - (25%)
Similarity:53/136 - (38%) Gaps:35/136 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 GHVLIVSGRVKPHPNKISLDL-------TD---NVNAQ-NESETVFLKIEANFREGQIIRSMFQP 68
            |.||.:.|.|.|:.::..::|       :|   :.|.: :.||.||     |.:|          
Human    17 GTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVF-----NSKE---------- 66

  Fly    69 GGGWQQEEISKNWKCDGPKNPLQPGQSFTFRVAVLQRCFEIYVNDQLYGSFEFVKFP-KQINYVR 132
            .|.|.:||       .||..|.|.||.|...:......|:..|.|..|..|.. :.| .::..|.
Human    67 QGSWGREE-------RGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRH-RLPLARVRLVE 123

  Fly   133 TYGDFE 138
            ..||.:
Human   124 VGGDVQ 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13950NP_608553.1 Gal-bind_lectin 10..144 CDD:459768 35/136 (26%)
Gal-bind_lectin 170..299 CDD:459768
LGALS7NP_002298.1 Gal-bind_lectin 11..133 CDD:214904 35/136 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.