DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13950 and lgals2b

DIOPT Version :9

Sequence 1:NP_001334728.1 Gene:CG13950 / 33267 FlyBaseID:FBgn0031289 Length:316 Species:Drosophila melanogaster
Sequence 2:XP_005172121.1 Gene:lgals2b / 393486 ZFINID:ZDB-GENE-040426-1590 Length:132 Species:Danio rerio


Alignment Length:135 Identity:28/135 - (20%)
Similarity:47/135 - (34%) Gaps:48/135 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 GHVLIVSGRVKP-----------HPNKISLDLTDNVNAQNESETVFLKIEANFREGQIIRSMFQP 68
            |..:.:||:|||           ..:.|:|......||..:|.|    |..|.::          
Zfish    13 GMEMKISGKVKPGCDAFSINIGHDDDAIALHFNPRFNAHGDSNT----IVCNSKQ---------- 63

  Fly    69 GGGWQQEEISKNWKCDGPKNPLQPGQSFTFRVAVLQRCFEIYVNDQLYGSFEFVKFPK--QINYV 131
             |||..|.....:       |.|.|:.|...:.        :.|:..|     :|.|:  .:::.
Zfish    64 -GGWGSEHREHCF-------PFQQGEEFKLSIT--------FNNETFY-----IKLPEGTMMSFP 107

  Fly   132 RTYGD 136
            ..:||
Zfish   108 NRFGD 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13950NP_001334728.1 None
lgals2bXP_005172121.1 GLECT 9..130 CDD:238025 28/135 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11346
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.