DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13950 and lgalslb

DIOPT Version :9

Sequence 1:NP_001334728.1 Gene:CG13950 / 33267 FlyBaseID:FBgn0031289 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001007175.1 Gene:lgalslb / 368889 ZFINID:ZDB-GENE-030616-570 Length:145 Species:Danio rerio


Alignment Length:129 Identity:35/129 - (27%)
Similarity:56/129 - (43%) Gaps:15/129 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 FGHVLIVSGRVKPHPNKISLDLTDNVNAQNESE---TVFLKIEANFREGQIIRSMFQPGGGWQQE 75
            |.|.::..|.:    :...:.||...|.:.|.|   .|.||:.|.|.|.|.:|:. :..|.|.:|
Zfish    23 FVHTVLNVGFL----HSFDISLTCGHNEEKEDEKLADVALKLSARFTERQFLRNA-RVSGKWSEE 82

  Fly    76 EISKNWKCDGPKNPLQPGQSFTFRVAVLQRCFEIYVN-DQLYGSFEFVKFPKQINYVRTYGDFE 138
            |....:      .|..|.|.|...:....:.|.|:|: .||:..:..||..:.||.:|..|..:
Zfish    83 EAPIAY------FPFIPDQPFRIEIHCEHQRFRIFVDGHQLFDFYHKVKSLQAINMIRIVGSLQ 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13950NP_001334728.1 None
lgalslbNP_001007175.1 Gal-bind_lectin 34..143 CDD:214904 32/114 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11346
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.