DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13950 and CG11374

DIOPT Version :9

Sequence 1:NP_001334728.1 Gene:CG13950 / 33267 FlyBaseID:FBgn0031289 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_608488.3 Gene:CG11374 / 33163 FlyBaseID:FBgn0031214 Length:401 Species:Drosophila melanogaster


Alignment Length:185 Identity:41/185 - (22%)
Similarity:71/185 - (38%) Gaps:46/185 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 FEKITQFHHRMLFPLV-FPRTLMCPDKVAFQSDVPRRYETGTVVAMEC--------IAKGPPTTE 192
            :||.::.|.|..|.:: .||..:|   ..|..          ::.|.|        ..:|.    
  Fly    23 YEKRSEAHRRKHFKVIQCPRPGLC---FVFHG----------MILMACEHFVIDFLTKQGS---- 70

  Fly   193 FSICFQCNDTGRTVLRFHVNFDRTTVSRS------YQREDNSFALSDEETEGEFPFVRGKLFKIA 251
             .||.:|:    .:|:......:..::|:      :..|:||..|:       |...|||.|.:.
  Fly    71 -EICEECD----VLLQIGSRLPQNYITRNSRLKGKWGPEENSSYLT-------FQLNRGKSFWMQ 123

  Fly   252 FGLGDRAFLIAVNGQYFTYYNFPGRPFSISTLKCFTNEVGDFAVRSLEYHSDSPL 306
            ..|.:..|.|:|||.:|..| |...|:..........:|.|..:.:. |.|:.|:
  Fly   124 ILLTEECFFISVNGYHFAKY-FHRMPYRWLEAVDVLGDVSDIVIDTY-YVSEYPI 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13950NP_001334728.1 None
CG11374NP_608488.3 Gal-bind_lectin 37..162 CDD:278752 31/154 (20%)
Gal-bind_lectin 226..369 CDD:278752
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464272
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3587
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11346
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.