DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13950 and lgals3b

DIOPT Version :9

Sequence 1:NP_001334728.1 Gene:CG13950 / 33267 FlyBaseID:FBgn0031289 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_999858.2 Gene:lgals3b / 325599 ZFINID:ZDB-GENE-030131-4324 Length:228 Species:Danio rerio


Alignment Length:125 Identity:32/125 - (25%)
Similarity:54/125 - (43%) Gaps:20/125 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 VLIVSGRVKPHPNKISLDLTDNVNAQNESETVFLKIEANFREG---QIIR-SMFQPGGGWQQEEI 77
            ::.::|.|||:..:.:      ||.:..::..| .|...|.||   .|:| ||.  |..|.:|| 
Zfish   107 LITINGEVKPNAKQFT------VNLRRGNDIAF-HINPRFSEGGKPVIVRNSMI--GNNWGREE- 161

  Fly    78 SKNWKCDGPKNPLQPGQSFTFRVAVLQRCFEIYVNDQLYGSFEFVKFP-KQINYVRTYGD 136
                 .:.|..|..||:.|..::.:....:::.||......|:...|. .||..:..|.|
Zfish   162 -----RELPSFPFVPGKPFEMKILITDTEYKVAVNKSHLLEFKHRVFELNQITGLSIYND 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13950NP_001334728.1 None
lgals3bNP_999858.2 Gal-bind_lectin 99..223 CDD:214904 32/125 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3587
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11346
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.