DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13950 and Lgals12

DIOPT Version :9

Sequence 1:NP_001334728.1 Gene:CG13950 / 33267 FlyBaseID:FBgn0031289 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001099803.1 Gene:Lgals12 / 293710 RGDID:1306914 Length:314 Species:Rattus norvegicus


Alignment Length:173 Identity:40/173 - (23%)
Similarity:60/173 - (34%) Gaps:45/173 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   163 VAFQSDVPRRYETGTVVAMECIAKGPPTTEFSICFQCNDT--GRTVLRFHVNFDRTTVSRSYQRE 225
            :..|..|||.                 ...|.:.|||...  .|..:.||.:      .|.|..:
  Rat    41 IMLQGVVPRH-----------------ARRFQVDFQCGCCLHPRPDVAFHFS------PRFYTVK 82

  Fly   226 D----NSFALSDEETEGEFPFV---RGKLFKIAFGLGDRAFLIAVNGQYFTYYNFPGRPFS-IST 282
            .    |:......:.|..:|.:   :|..|.|.|...:....::||||:|.:|.: ..|.| :.|
  Rat    83 PHVICNTLQGGLWQKEVRWPGIALQKGASFLILFLFDNEEVKVSVNGQHFLHYRY-RLPLSRVDT 146

  Fly   283 LKC----------FTNEVGDFAVRSLEYHSDSPLLARVEKLSI 315
            |..          |.| :..|...|.||....|||....:|.:
  Rat   147 LDISGDILVKAVGFLN-ISPFVEGSREYPVGYPLLLYSPRLEV 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13950NP_001334728.1 None
Lgals12NP_001099803.1 Gal-bind_lectin 26..160 CDD:395266 30/142 (21%)
Gal-bind_lectin 195..313 CDD:214904
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344248
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3587
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11346
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.