powered by:
Protein Alignment CG13950 and LGALS13
DIOPT Version :9
Sequence 1: | NP_001334728.1 |
Gene: | CG13950 / 33267 |
FlyBaseID: | FBgn0031289 |
Length: | 316 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_016882204.1 |
Gene: | LGALS13 / 29124 |
HGNCID: | 15449 |
Length: | 170 |
Species: | Homo sapiens |
Alignment Length: | 69 |
Identity: | 23/69 - (33%) |
Similarity: | 30/69 - (43%) |
Gaps: | 6/69 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 208 RFHVNFDRTTVSRSYQREDNSFALSDEETEGEFPFVRGKLFKIAFGLGDRAFLIAVNGQYFTYYN 272
||.|:|....|.. :||...:.| |||....||..||.|::...:....:.|.||| ...|.
Human 84 RFRVHFGNHVVMN--RREFGIWML--EETTDYVPFEDGKQFELCIYVHYNEYEIKVNG--IRIYG 142
Fly 273 FPGR 276
|..|
Human 143 FVHR 146
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C165150770 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3587 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR11346 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
4 | 3.840 |
|
Return to query results.
Submit another query.