DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13950 and LGALS13

DIOPT Version :9

Sequence 1:NP_001334728.1 Gene:CG13950 / 33267 FlyBaseID:FBgn0031289 Length:316 Species:Drosophila melanogaster
Sequence 2:XP_016882204.1 Gene:LGALS13 / 29124 HGNCID:15449 Length:170 Species:Homo sapiens


Alignment Length:69 Identity:23/69 - (33%)
Similarity:30/69 - (43%) Gaps:6/69 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   208 RFHVNFDRTTVSRSYQREDNSFALSDEETEGEFPFVRGKLFKIAFGLGDRAFLIAVNGQYFTYYN 272
            ||.|:|....|..  :||...:.|  |||....||..||.|::...:....:.|.|||  ...|.
Human    84 RFRVHFGNHVVMN--RREFGIWML--EETTDYVPFEDGKQFELCIYVHYNEYEIKVNG--IRIYG 142

  Fly   273 FPGR 276
            |..|
Human   143 FVHR 146



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165150770
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3587
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11346
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.