DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13950 and LGALS9B

DIOPT Version :9

Sequence 1:NP_001334728.1 Gene:CG13950 / 33267 FlyBaseID:FBgn0031289 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001354221.1 Gene:LGALS9B / 284194 HGNCID:24842 Length:356 Species:Homo sapiens


Alignment Length:374 Identity:82/374 - (21%)
Similarity:121/374 - (32%) Gaps:136/374 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VPF----------GHVLIVSGRV-KPHPNKISLDLTDNVNAQNESETVFLKIEANFREGQIIRSM 65
            |||          |..:.|:|.| .....:.::|.....:..:    :.......|.:|..:...
Human    15 VPFSGTIQGGLQDGFQITVNGAVLSSSGTRFAVDFQTGFSGND----IAFHFNPRFEDGGYVVCN 75

  Fly    66 FQPGGGWQQEEISKNWKCDGPKNPLQPGQSFTFRVAVLQRCFEIYVNDQLYGS-FEFVKFPK--- 126
            .:..|.|..||...:.       |.|.|..|.....|....|::.||..|:.. |..|.|.:   
Human    76 TRQKGRWGPEERKMHM-------PFQKGMPFDLCFLVQSSDFKVMVNGSLFVQYFHRVPFHRVDT 133

  Fly   127 -------QINYVRTYGDFEKITQFHHRMLFPLVFPRTLMCPDKVAFQSDVP-------------R 171
                   |::|:    .|:.              |||:  |.:.|| |.||             |
Human   134 ISVNGSVQLSYI----SFQN--------------PRTV--PVQPAF-STVPFSQPVCFPPRPRGR 177

  Fly   172 RYE------------TGTVVAMECIAKGP-------------PTTEFSICFQCNDTG-------- 203
            |.:            |.||:.....|.|.             |...:.:.|.....|        
Human   178 RQKPPSVRPANPAPITQTVIHTVQSASGQMFSQTPAIPPMMYPHPAYPMPFITTIPGGLYPSKSI 242

  Fly   204 ---RTVL----RFHVN--------------FDRTTVSRSYQREDNSFALSDEETEGEFPFVRGKL 247
               .|||    |||:|              ||...|.|:.| .:||:...:.....:.|||||:.
Human   243 ILSGTVLPSAQRFHINLCSGSHIAFHMNPRFDENAVVRNTQ-INNSWGSEERSLPRKMPFVRGQS 306

  Fly   248 FKIAFGLGDRAFLIAVNGQY-FTYY----NFPGRPFSISTLKCFTNEVG 291
            |.:..........:||:||: |.||    |.|    :|:.|     |||
Human   307 FSVWILCEAHCLKVAVDGQHVFEYYHRLRNLP----TINKL-----EVG 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13950NP_001334728.1 None
LGALS9BNP_001354221.1 GLECT 16..146 CDD:238025 27/144 (19%)
Beta-galactoside binding 1. /evidence=ECO:0000250 82..88 3/5 (60%)
DNA_pol3_gamma3 <150..>227 CDD:331207 17/79 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 170..190 2/19 (11%)
Gal-bind_lectin 233..355 CDD:214904 35/124 (28%)
Beta-galactoside binding 2. /evidence=ECO:0000250 288..294 0/5 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165150753
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3587
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11346
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.