DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13950 and Lgals5

DIOPT Version :9

Sequence 1:NP_001334728.1 Gene:CG13950 / 33267 FlyBaseID:FBgn0031289 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_037108.1 Gene:Lgals5 / 25475 RGDID:3004 Length:145 Species:Rattus norvegicus


Alignment Length:145 Identity:38/145 - (26%)
Similarity:60/145 - (41%) Gaps:23/145 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   163 VAFQSDVPR-RYETGTVVAMECIAKGPPTTEFSICFQCNDTGRTVLRFHVN--FDRTTVSRSYQR 224
            |.|.:.:|. .|.:.::|....:..  ....|.|..:|...    :.||:|  ||...|.|:.| 
  Rat    15 VPFFTSIPNGLYPSKSIVISGVVLS--DAKRFQINLRCGGD----IAFHLNPRFDENAVVRNTQ- 72

  Fly   225 EDNSFALSDEETEGEFPFVRGKLFKIAFGLGDRAFLIAVNGQYFTYY-----NFPGRPFSISTLK 284
            .:||:...:....|..||.||:.|.:........|.:||:||:...|     |.|    .|:||:
  Rat    73 INNSWGPEERSLPGSMPFSRGQRFSVWILCEGHCFKVAVDGQHICEYSHRLMNLP----DINTLE 133

  Fly   285 CFTNEVGDFAVRSLE 299
            .    .||..:..:|
  Rat   134 V----AGDIQLTHVE 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13950NP_001334728.1 None
Lgals5NP_037108.1 Gal-bind_lectin 22..144 CDD:214904 35/136 (26%)
Beta-galactoside binding. /evidence=ECO:0000255 77..83 0/5 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3587
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11346
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.