DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13950 and Lgals4

DIOPT Version :9

Sequence 1:NP_001334728.1 Gene:CG13950 / 33267 FlyBaseID:FBgn0031289 Length:316 Species:Drosophila melanogaster
Sequence 2:XP_008757335.1 Gene:Lgals4 / 25474 RGDID:3003 Length:349 Species:Rattus norvegicus


Alignment Length:322 Identity:69/322 - (21%)
Similarity:114/322 - (35%) Gaps:79/322 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 KPHPNKISLDLTDNVNAQNESETVFLKIEANFR----EGQIIRSMFQP--------------GGG 71
            :|.|..:|:.:  ::..|..::....:...||.    ||..|...|.|              .|.
  Rat    21 RPIPGGLSVGM--SIYIQGIAKDNMRRFHVNFAVGQDEGADIAFHFNPRFDGWDKVVFNTMQSGQ 83

  Fly    72 WQQEEISKNWKCDGPKNPLQPGQSFTFRVAVLQRCFEIYVNDQLYGSFEF-VKFPKQ-INYVRTY 134
            |.:||..|:.       |.|.|..|.....|:...:::.||...:  :|: .:.|.| :.:::..
  Rat    84 WGKEEKKKSM-------PFQKGHHFELVFMVMSEHYKVVVNGTPF--YEYGHRLPLQMVTHLQVD 139

  Fly   135 GDFE-----------KITQFHHRMLFPLVFPRTLMCPDKV----------AFQSDVP--RRYETG 176
            ||.|           ..:|:...|..| .:|.....|.::          .|...||  ...:.|
  Rat   140 GDLELQSINFLGGQPAASQYPGTMTIP-AYPSAGYNPPQMNSLPVMAGPPIFNPPVPYVGTLQGG 203

  Fly   177 TVVAMECIAKG---PPTTEFSICFQCNDTGRTVLRFHVN--FDRTTVSRSYQREDNSFALSDEET 236
            .......|.||   |......|.|:...||.  :.||:|  .....|..||.   |....|:|..
  Rat   204 LTARRTIIIKGYVLPTAKNLIINFKVGSTGD--IAFHMNPRIGDCVVRNSYM---NGSWGSEERK 263

  Fly   237 EGEFPFVRGKLFKIAFGLGDRAFLIAVN----GQYFTYYNFPGRPFSISTLKCFTNEVGDFA 294
            ....||..|:.|.::.|:   .|.:..|    |.:.::      |..:| ::|.|:....||
  Rat   264 IPYNPFGAGQFFDVSLGV---LFSVPTNPSLAGPHLSF------PLQLS-IRCGTDRFKVFA 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13950NP_001334728.1 None
Lgals4XP_008757335.1 Gal-bind_lectin 24..148 CDD:214904 28/134 (21%)
Gal-bind_lectin 201..348 CDD:214904 32/130 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3587
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.