DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13950 and F49F1.18

DIOPT Version :10

Sequence 1:NP_608553.1 Gene:CG13950 / 33267 FlyBaseID:FBgn0031289 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001294425.1 Gene:F49F1.18 / 24104609 WormBaseID:WBGene00235368 Length:195 Species:Caenorhabditis elegans


Alignment Length:86 Identity:28/86 - (32%)
Similarity:39/86 - (45%) Gaps:20/86 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 EGQIIRSMFQPGGGWQQEEISKNWKCDGPKNPLQPGQSFTFRVAVLQR--CFEIYVNDQLYGSFE 120
            :|.::|:.|. .|.||.||     |..|...|:    |..|.|.::.:  ..||:||    |.| 
 Worm   114 KGLVVRNRFL-NGAWQVEE-----KWGGNPFPV----STPFNVTLINQPSHIEIHVN----GVF- 163

  Fly   121 FVKFPKQI-NYVRTYG--DFE 138
            ||.|..:. |..|.|.  ||:
 Worm   164 FVNFNHRTPNPSRDYQGLDFQ 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13950NP_608553.1 Gal-bind_lectin 10..144 CDD:459768 28/86 (33%)
Gal-bind_lectin 170..299 CDD:459768
F49F1.18NP_001294425.1 GLECT 69..194 CDD:214596 28/86 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.