DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13950 and Lgalsl

DIOPT Version :9

Sequence 1:NP_001334728.1 Gene:CG13950 / 33267 FlyBaseID:FBgn0031289 Length:316 Species:Drosophila melanogaster
Sequence 2:XP_030101642.1 Gene:Lgalsl / 216551 MGIID:1916114 Length:219 Species:Mus musculus


Alignment Length:143 Identity:36/143 - (25%)
Similarity:67/143 - (46%) Gaps:29/143 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VPF-GHV---------LIVSGRVKPHPNKISLDLTDNVNAQNESETVFLKIEANFREGQIIRSMF 66
            ||| ||:         ::|.|.|..:|...::.||.. ::::....|.::::|.|.:.|::|:..
Mouse    85 VPFCGHIKGGMRPGKKVLVMGIVDLNPESFAISLTCG-DSEDPPADVAIELKAVFTDRQLLRNSC 148

  Fly    67 QPG-GGWQQEEISKNWKCDGPKNPLQPGQSFTFRVAVLQRC----FEIYVN-DQLYGSFEFVKFP 125
            ..| .|.:|..|        |..|..|.|  .|||.:|  |    |.::|: .||:..:..::..
Mouse   149 ISGERGEEQSAI--------PYFPFIPDQ--PFRVEIL--CEHPRFRVFVDGHQLFDFYHRIQTL 201

  Fly   126 KQINYVRTYGDFE 138
            ..|:.::..||.:
Mouse   202 SAIDTIKINGDLQ 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13950NP_001334728.1 None
LgalslXP_030101642.1 Gal-bind_lectin 93..217 CDD:214904 31/135 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3587
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11346
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.