DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13950 and F49F1.10

DIOPT Version :9

Sequence 1:NP_001334728.1 Gene:CG13950 / 33267 FlyBaseID:FBgn0031289 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_500491.1 Gene:F49F1.10 / 186066 WormBaseID:WBGene00018650 Length:215 Species:Caenorhabditis elegans


Alignment Length:144 Identity:33/144 - (22%)
Similarity:47/144 - (32%) Gaps:39/144 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 GPPTTEFSICFQCNDTGRT----------------------VLRFHVNFDRTTVSRSYQREDNSF 229
            ||.||...|.....|||:.                      |..|.|...:..|:|: :..:..:
 Worm    75 GPFTTTLPIPGGYWDTGKIMRIYGIPGSGRWTINLAKSKVWVFHFAVEPSKGLVART-RHLNGKW 138

  Fly   230 ALSDEETEGEFPFVRGKLFKIAFGLGDRAFLIAVNGQYFTYYNF----PGRPF-SISTLKCFTNE 289
            .:.  ||.|..||.....|.:..........|.|||.:|..:|.    |.|.: |||        
 Worm   139 QVG--ETYGGNPFRANAAFNVTMVNQPTHIEIHVNGAFFVNFNHRVSNPSRDYLSIS-------- 193

  Fly   290 VGDFAVRSLEYHSD 303
             ..|..|...:|.:
 Worm   194 -NSFLSRKWSFHDN 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13950NP_001334728.1 None
F49F1.10NP_500491.1 GLECT 80..204 CDD:214596 28/135 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164637
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3587
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11346
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.