DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13950 and F49F1.9

DIOPT Version :10

Sequence 1:NP_608553.1 Gene:CG13950 / 33267 FlyBaseID:FBgn0031289 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_500490.1 Gene:F49F1.9 / 186065 WormBaseID:WBGene00018649 Length:210 Species:Caenorhabditis elegans


Alignment Length:104 Identity:29/104 - (27%)
Similarity:38/104 - (36%) Gaps:31/104 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   202 TGRTVLRFH---------VNFDR--------------TTVSRSYQREDNSFALSDEETEGEFPFV 243
            ||: ||||:         :|.||              ..|.|: :..:..|.|.|  |.|..||.
 Worm    93 TGK-VLRFYGVPGRGRWSINLDREKEWLFHFASQPDLRRVVRT-RHLNGKFLLGD--TYGGNPFP 153

  Fly   244 RGKLFKIAFGLGDRAFLIAVNGQYFTYYNF----PGRPF 278
            .|..|.:..........|.||..:||.||.    |.|.:
 Worm   154 AGANFNVTMINQPTHIEIYVNQVFFTNYNHRTPNPSRNY 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13950NP_608553.1 Gal-bind_lectin 10..144 CDD:459768
Gal-bind_lectin 170..299 CDD:459768 29/104 (28%)
F49F1.9NP_500490.1 GLECT 82..209 CDD:214596 29/104 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.