DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13950 and F46A8.8

DIOPT Version :9

Sequence 1:NP_001334728.1 Gene:CG13950 / 33267 FlyBaseID:FBgn0031289 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_492881.2 Gene:F46A8.8 / 185824 WormBaseID:WBGene00009751 Length:236 Species:Caenorhabditis elegans


Alignment Length:136 Identity:37/136 - (27%)
Similarity:50/136 - (36%) Gaps:29/136 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 PRRYETGTVVA-MECIAKGP--PTTEFSICFQCNDTGRTVLRFH---------VNFD--RTTVSR 220
            ||...|...|. ||.: .||  |...:.|.....|||: ||||:         :|.|  :|.:..
 Worm    85 PRPVPTPKPVENMETL-NGPFGPDVRYPIPGGYWDTGK-VLRFYGVPGQGRWSINLDQAKTWLFH 147

  Fly   221 SYQREDNSFALSDEETEGEF---------PFVRGKLFKIAFGLGDRAFLIAVNGQYFTYYNF--- 273
            ...:.|....:...|..|:|         ||..|..|.:..........|.||..:||.||.   
 Worm   148 FASQPDLGHVVRTREQNGQFQTPDTYGGNPFPAGANFNVTMVNQPTHIEIHVNQVFFTNYNHRTG 212

  Fly   274 -PGRPF 278
             |.|.:
 Worm   213 NPSRDY 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13950NP_001334728.1 None
F46A8.8NP_492881.2 GLECT 108..235 CDD:214596 28/112 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164639
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3587
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11346
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.