Sequence 1: | NP_001334728.1 | Gene: | CG13950 / 33267 | FlyBaseID: | FBgn0031289 | Length: | 316 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_741306.2 | Gene: | F38A1.11 / 185441 | WormBaseID: | WBGene00009524 | Length: | 299 | Species: | Caenorhabditis elegans |
Alignment Length: | 207 | Identity: | 41/207 - (19%) |
---|---|---|---|
Similarity: | 63/207 - (30%) | Gaps: | 76/207 - (36%) |
- Green bases have known domain annotations that are detailed below.
Fly 9 LTEVPF--GHVLIVSGRVKPHPNKISLDLTDNVNAQNESETVFLKIEANFREGQIIRSMFQPGGG 71
Fly 72 WQQEEISKNWKCDGPKNPLQPGQSFTFRVAVLQRCFEIYVNDQLYGSFEFVKFPKQINYVRTYGD 136
Fly 137 FEKITQFHHRMLFPLVFPRTLMCPDKVAFQSDVPRRYETGTVVAMECIAKGPPTTEFSICFQCND 201
Fly 202 TGRTVLRFHVNF 213 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG13950 | NP_001334728.1 | None | |||
F38A1.11 | NP_741306.2 | PAN_3 | 1..67 | CDD:369790 | |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3587 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |