DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13950 and C09F9.1

DIOPT Version :10

Sequence 1:NP_608553.1 Gene:CG13950 / 33267 FlyBaseID:FBgn0031289 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_497052.1 Gene:C09F9.1 / 182455 WormBaseID:WBGene00007478 Length:131 Species:Caenorhabditis elegans


Alignment Length:55 Identity:12/55 - (21%)
Similarity:20/55 - (36%) Gaps:6/55 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 DLTDNVNAQNESET------VFLKIEANFREGQIIRSMFQPGGGWQQEEISKNWK 82
            |:....|..|..:|      |||.:........::.|....|..|..|::.:..|
 Worm    77 DIVSIKNRPNSCDTCHVASLVFLIVLVIAISTPVLLSANNGGFKWIAEKLKEEPK 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13950NP_608553.1 Gal-bind_lectin 10..144 CDD:459768 12/55 (22%)
Gal-bind_lectin 170..299 CDD:459768
C09F9.1NP_497052.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.