DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13950 and lec-10

DIOPT Version :9

Sequence 1:NP_001334728.1 Gene:CG13950 / 33267 FlyBaseID:FBgn0031289 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_504647.1 Gene:lec-10 / 179034 WormBaseID:WBGene00002273 Length:192 Species:Caenorhabditis elegans


Alignment Length:209 Identity:44/209 - (21%)
Similarity:62/209 - (29%) Gaps:70/209 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 GHVLIVSGRVK-PHPNKISLDLTDNVNAQNESETVFLKIEANFREGQIIRSMFQPGGGWQQEEIS 78
            |..:.|.|.|: .|....:::|....|       |.|.:...|....::....|..|.|      
 Worm    22 GSTISVHGHVRHGHHKNFAVELLSGPN-------VVLHVNFRFHHEHVVVMNSQFSGMW------ 73

  Fly    79 KNWKCDGP----KNPLQPGQSFTFRVAVLQRCFEIYVNDQLYGSFEFVKFPKQ-INYVRTYGDFE 138
                  ||    ||||...:.|...:.|....:.|.||......:.. ::|.| :..:...||..
 Worm    74 ------GPEIRHKNPLHHSEHFHLSIKVHAGYYHISVNGHHLADYPH-RYPYQSVQAIGLKGDVH 131

  Fly   139 KITQFHHRMLFPLVFPRTLMCPDKVAFQS-DVPRR--------------YETGTVVA-------- 180
                                 .|||.|:. ...||              |.|.|.||        
 Worm   132 ---------------------VDKVHFEGFHFQRRWDGHVDHGHSGYNAYGTETYVAPVFVQPNF 175

  Fly   181 MECIAKGPPTTEFS 194
            |...|..||...|:
 Worm   176 MPYGAPPPPVQNFN 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13950NP_001334728.1 None
lec-10NP_504647.1 GLECT 13..138 CDD:214596 31/156 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3587
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11346
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.870

Return to query results.
Submit another query.