DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13950 and lec-12

DIOPT Version :9

Sequence 1:NP_001334728.1 Gene:CG13950 / 33267 FlyBaseID:FBgn0031289 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001023759.2 Gene:lec-12 / 178548 WormBaseID:WBGene00017080 Length:340 Species:Caenorhabditis elegans


Alignment Length:356 Identity:75/356 - (21%)
Similarity:127/356 - (35%) Gaps:102/356 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 EVPF----------GHVLIVSGRVKP----HPNKISLDL----------TDN----VNAQNESET 47
            ::||          |..::|||.|.|    ...:..:||          .||    .|.:.:::|
 Worm    19 DLPFVSSIVGGLFAGRAIVVSGMVLPGFASDRKRFQIDLCCGLLIDGDHMDNKALHFNPRFDAKT 83

  Fly    48 VFLKIEANFREGQIIRSMFQPGGGWQQEEISKNWKCDGPKNPLQPGQSFTFRVAVLQRCFEIYVN 112
            .:.....:  :..:|.|..  .|.|..||     :.|   ||.:.|:.|..|:.|.::.|:|..:
 Worm    84 GWFSGPGD--DKLVINSFV--SGRWGNEE-----RFD---NPFKEGEPFQIRIMVFEKYFKISAS 136

  Fly   113 DQLYGSFEFVKFPKQ--INYVRTYG-------DFEKITQFHHRMLFPLVFPRTLMCP-------- 160
            .:     ....||.:  :..:||..       |:   .:||..:........||:.|        
 Worm   137 GK-----HMCDFPHRVPVESIRTISINGNIRVDY---VEFHPPIGIGADGKPTLVAPTPKQEVIT 193

  Fly   161 --DK--VAFQSDVPRRYETGTVVAMECIAKGPPTTEFSIC-------FQCNDTGRTVLRFHVNFD 214
              ||  |.|:..:|    .|..|:       |.:..|:|.       |..|...:....||...|
 Worm   194 KIDKPNVPFELPLP----PGGFVS-------PQSARFTITPFLSSERFTINLKSKGEFLFHFRVD 247

  Fly   215 --------RTTVSRSYQREDNSFALSDEETEGEFPFVRGKLFKIAFGLGDRAFLIAVNGQYFT-- 269
                    :..|.|:..:....: |::|.|.|.|||.:|....|.|....::..:.|:|..|.  
 Worm   248 MPNQAQKIKPHVIRNSSKNGVKW-LTEERTFGTFPFHKGITHDIVFTAYGKSVTVDVDGAPFVKF 311

  Fly   270 YYNFPGRPFSISTLKCFTNEVGDFAVRSLEY 300
            .|.....|.::..:    ..|||..:...|:
 Worm   312 VYRDGDDPVNVDQI----TVVGDVLIHRFEH 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13950NP_001334728.1 None
lec-12NP_001023759.2 GLECT 21..167 CDD:238025 34/165 (21%)
Gal-bind_lectin 208..337 CDD:214904 30/140 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.