DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13950 and lec-11

DIOPT Version :9

Sequence 1:NP_001334728.1 Gene:CG13950 / 33267 FlyBaseID:FBgn0031289 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001023191.1 Gene:lec-11 / 177420 WormBaseID:WBGene00002274 Length:232 Species:Caenorhabditis elegans


Alignment Length:127 Identity:27/127 - (21%)
Similarity:48/127 - (37%) Gaps:32/127 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 PHPNKISLDLTDNVNAQNESETVFLKIEANFREGQIIRSMFQPGGGWQQEEISKNWKCDGPKNPL 90
            |..|.::|.::..:.:..::..||..::.               |.|.:||        ..:|.:
 Worm    45 PTKNGVALHISVRMGSYGQNVIVFNHLQR---------------GRWHREE--------HHQNTI 86

  Fly    91 QPGQSFTFRVAVLQRCFEIYVNDQLYGSFEFVKFPKQINYVRTYGD-------FEKITQFHH 145
            ..|:.|..|:....|.:.|:|:....|.:...|.||:|..:...||       ||...  ||
 Worm    87 MFGRPFCMRIHNEHRKYSIHVDGHHIGHYHHHKCPKRIVAMTVRGDLRVGKIHFENFK--HH 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13950NP_001334728.1 None
lec-11NP_001023191.1 Gal-bind_lectin 11..140 CDD:278752 23/117 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11346
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.